PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_8582_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MIKC_MADS
Protein Properties Length: 237aa    MW: 27074.5 Da    PI: 10.0176
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_8582_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.99.6e-322474151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Neem_8582_f_1 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 74
                   79***********************************************95 PP

2K-box74.62.7e-25101190392
          K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                    +++++ +ee+    +qqe+akL+ +i+nLq+++R++lGe+L+ Ls+keL++Le++Lek++++iRskK+  l+++ + l+ k  e+++ ++
  Neem_8582_f_1 101 NAQDNGVEEERFVFYQQEAAKLRVQISNLQNSNRNMLGESLSALSVKELKNLETRLEKGISRIRSKKEIELHNNNQLLRAKIAENERGQQ 190
                    567888999*********************************************************************999998887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-421675IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.091676IPR002100Transcription factor, MADS-box
CDDcd002651.87E-451793No hitNo description
SuperFamilySSF554551.23E-331791IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-331838IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001872IPR002100Transcription factor, MADS-box
PfamPF003198.6E-272572IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-333853IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-335374IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.983112198IPR002487Transcription factor, K-box
PfamPF014864.0E-18114185IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MAFPNESREE SPKRKMGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL  60
IVFSSRGRLY EYSNNSVKST IERYKKASAD SSTTGSVSEA NAQDNGVEEE RFVFYQQEAA  120
KLRVQISNLQ NSNRNMLGES LSALSVKELK NLETRLEKGI SRIRSKKEIE LHNNNQLLRA  180
KIAENERGQQ SMNLMPGGSS YEIIQSQPFD SRSYFQVNAL QPTNHYPRQD QMAIQLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-211688173Myocyte-specific enhancer factor 2B
1tqe_Q2e-211688173Myocyte-specific enhancer factor 2B
1tqe_R2e-211688173Myocyte-specific enhancer factor 2B
1tqe_S2e-211688173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN0508541e-65JN050854.1 Mangifera indica cultivar SiJi AGAMOUS-like protein (AG1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006449577.11e-144hypothetical protein CICLE_v10016427mg
RefseqXP_006449578.11e-144hypothetical protein CICLE_v10016427mg
RefseqXP_006449580.11e-144hypothetical protein CICLE_v10016427mg
SwissprotQ408721e-120AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLQ05KK31e-144Q05KK3_CITUN; MADS-box protein
TrEMBLV4TQL41e-144V4TQL4_9R
STRINGVIT_10s0003g02070.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61812237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-113MIKC_MADS family protein